PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10036130
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family LBD
Protein Properties Length: 238aa    MW: 26026.3 Da    PI: 6.7239
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10036130genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.41.2e-43511501100
       DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                  +CaaCk+lrr+Ca++Cvlapyfp +qp+kf ++h++FGasn++k+l++lpee+r da+ss+vyeA ar+rdPvyG++g i++lq+q++ l+a+la+ +
  Lus10036130  51 PCAACKILRRRCADKCVLAPYFPPSQPAKFSIAHRVFGASNIIKFLQELPEEQRADAVSSMVYEATARIRDPVYGCAGAISHLQHQVNDLQAQLAKSQ 148
                  7**********************************************************************************************999 PP

       DUF260  99 ee 100
                  ++
  Lus10036130 149 AQ 150
                  87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.97350151IPR004883Lateral organ boundaries, LOB
PfamPF031951.7E-4351148IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 238 aa     Download sequence    Send to blast
MEFSEAKAAT TTRTNNIPSS TTSSSTPPLL PPSPDSTSSP PPQPPVIIIS PCAACKILRR  60
RCADKCVLAP YFPPSQPAKF SIAHRVFGAS NIIKFLQELP EEQRADAVSS MVYEATARIR  120
DPVYGCAGAI SHLQHQVNDL QAQLAKSQAQ VLTMQAHQAH LMAQVLCLDM AHHPPPQPSS  180
DTFTICNEDN IPHHQQTHTQ QQQQQQQQQH GGNSSSCYAF DDTTQLLMGP LWEPLWT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008370637.12e-78PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR04e-67LBD1_ARATH; LOB domain-containing protein 1
TrEMBLG7IKN31e-76G7IKN3_MEDTR; Lateral organ boundaries (LOB) domain protein
TrEMBLM5W0702e-76M5W070_PRUPE; Uncharacterized protein
STRINGGLYMA13G40370.21e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.16e-63LOB domain-containing protein 1